PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G389300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 321aa    MW: 34053.4 Da    PI: 7.8243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G389300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+ lv +v+++G+g+W+++++  g+ R+ k+c++rw +yl
  Sevir.9G389300.1.p 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPASTGLMRCSKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding45.22.2e-1467112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg ++ eEd l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sevir.9G389300.1.p  67 RGGFSGEEDRLIAHLQALLGNR-WAAIASYLP-DRTDNDVKNYWNTHL 112
                         678999****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.885965IPR017930Myb domain
SuperFamilySSF466894.87E-3011108IPR009057Homeodomain-like
SMARTSM007177.1E-131363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
CDDcd001672.22E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2265116IPR009057Homeodomain-like
SMARTSM007177.5E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129418.50766116IPR017930Myb domain
PfamPF002491.4E-1367112IPR001005SANT/Myb domain
CDDcd001673.29E-1170111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PASTGLMRCS KSCRLRWTNY  60
LRPGIRRGGF SGEEDRLIAH LQALLGNRWA AIASYLPDRT DNDVKNYWNT HLKKKLLLLQ  120
QQQKMQQRAS AALSTPPPPP HKGQWELKLQ TDIDLARRAL RDALSCSPPA PAPGTTTTSG  180
HGGTGPAPPP LIAEPAAALA QAYALTARDV PGVLDGWSPR AGKNGRSGPA TPPPPVAAES  240
ASGSTSELTE CSASASSASD KRAAPVAGQL FAREEEKAAA DGEVPPLSEI ESWLLEDGGG  300
EQKPVLDGLL LDAALRNFGF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9628481e-150EU962848.1 Zea mays clone 246006 myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984215.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-89MYB06_ANTMA; Myb-related protein 306
TrEMBLK4AIY21e-173K4AIY2_SETIT; Uncharacterized protein
STRINGSi038845m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.25e-79myb domain protein 96